PDB entry 1cq4
View 1cq4 on RCSB PDB site
Description: ci2 mutant with tetraglutamine (mgqqqqgm) replacing met59
Class: hydrolase inhibitor
Keywords: serine protease inhibitor, polyglutamine insertion mutant, subtilisin- chymotrypsin inhibitor-2, immune system, hydrolase inhibitor
Deposited on
1998-11-17, released
1998-11-25
The last revision prior to the SCOPe 2.04 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.24
AEROSPACI score: -1.54
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: protein (serine proteinase inhibitor 2)
Species: Hordeum vulgare [TaxId:4513]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d1cq4.1 - Chain 'B':
Compound: protein (serine proteinase inhibitor 2)
Species: Hordeum vulgare [TaxId:4513]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d1cq4.1 - Heterogens: SO4, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>1cq4A (A:)
mktewpelvgksveeakkvilqdkpeaqiivlpvgtivtmgqqqqgm
Sequence, based on observed residues (ATOM records): (download)
>1cq4A (A:)
ktewpelvgksveeakkvilqdkpeaqiivlpvgtiv
- Chain 'B':
Sequence, based on SEQRES records: (download)
>1cq4B (B:)
eyridrvrlfvdkldniaqvprvg
Sequence, based on observed residues (ATOM records): (download)
>1cq4B (B:)
yridrvrlfvdkldniaqvprvg