PDB entry 1cq4

View 1cq4 on RCSB PDB site
Description: ci2 mutant with tetraglutamine (mgqqqqgm) replacing met59
Class: hydrolase inhibitor
Keywords: serine protease inhibitor, polyglutamine insertion mutant, subtilisin- chymotrypsin inhibitor-2, immune system, hydrolase inhibitor
Deposited on 1998-11-17, released 1998-11-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.24
AEROSPACI score: -1.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (serine proteinase inhibitor 2)
    Species: Hordeum vulgare [TaxId:4513]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1cq4.1
  • Chain 'B':
    Compound: protein (serine proteinase inhibitor 2)
    Species: Hordeum vulgare [TaxId:4513]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1cq4.1
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cq4A (A:)
    mktewpelvgksveeakkvilqdkpeaqiivlpvgtivtmgqqqqgm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cq4A (A:)
    ktewpelvgksveeakkvilqdkpeaqiivlpvgtiv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1cq4B (B:)
    eyridrvrlfvdkldniaqvprvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cq4B (B:)
    yridrvrlfvdkldniaqvprvg