PDB entry 1cq3

View 1cq3 on RCSB PDB site
Description: structure of a soluble secreted chemokine inhibitor, vcci, from cowpox virus
Class: cytokine
Keywords: beta sandwich, chemokine, cytokine
Deposited on 1999-08-05, released 1999-11-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.213
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: viral chemokine inhibitor
    Species: Cowpox virus [TaxId:10243]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cq3a_
  • Chain 'B':
    Compound: viral chemokine inhibitor
    Species: Cowpox virus [TaxId:10243]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cq3b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cq3A (A:)
    dykddddkqsfssssscteeenkhhmgidviikvtkqdqtptndkicqsvtevtesedes
    eevvkgdpttyytvvgggltmdfgftkcpkissiseysdgntvnarlssvspgqgkdspa
    itreealsmikdcemsinikcseeekdsnikthpvlgsnishkkvsyediigstivdtkc
    vknleisvrigdmckesselevkdgfkyvdgsasedaaddtslinsakliacv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cq3A (A:)
    sfssssscteeenkhhmgidviikvtkqdqtptndkicqsvtevtesedeseevvkgdpt
    tyytvvgggltmdfgftkcpkissiseysdgntvnarlssvspgqgkdspaitreealsm
    ikdcemsinikcseeekdsnikthpvlgsnishkkvsyediigstivdtkcvknleisvr
    igdmckesselevkdgfkyvdgsasedaaddtslinsakliacv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1cq3B (B:)
    dykddddkqsfssssscteeenkhhmgidviikvtkqdqtptndkicqsvtevtesedes
    eevvkgdpttyytvvgggltmdfgftkcpkissiseysdgntvnarlssvspgqgkdspa
    itreealsmikdcemsinikcseeekdsnikthpvlgsnishkkvsyediigstivdtkc
    vknleisvrigdmckesselevkdgfkyvdgsasedaaddtslinsakliacv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cq3B (B:)
    sfssssscteeenkhhmgidviikvtkqdqtptndkicqsvtevtesedeseevvkgdpt
    tyytvvgggltmdfgftkcpkissiseysdgntvnarlssvspgqgkdspaitreealsm
    ikdcemsinikcseeekdsnikthpvlgsnishkkvsyediigstivdtkcvknleisvr
    igdmckesselevkdgfkyvdgsasedaaddtslinsakliacv