PDB entry 1cq2

View 1cq2 on RCSB PDB site
Description: neutron struture of fully deuterated sperm whale myoglobin at 2.0 angstrom
Class: oxygen storage/transport
Keywords: helical, globular, all-hydrogen containing structure, oxygen storage-transport complex
Deposited on 1999-08-04, released 1999-08-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: NEUT
Resolution: 2 Å
R-factor: 0.16
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1cq2a_
  • Heterogens: HEM, DOD

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cq2A (A:)
    vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
    lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
    gdfgadaqgamnkalelfrkdiaakykelgyqg