PDB entry 1cq2

View 1cq2 on RCSB PDB site
Description: neutron structure of fully deuterated sperm whale myoglobin at 2.0 angstrom
Deposited on 1999-08-04, released 1999-08-16
The last revision prior to the SCOP 1.55 freeze date was dated 2000-06-26, with a file datestamp of 2000-06-26.
Experiment type: NEUT
Resolution: 2 Å
R-factor: 0.16
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1cq2a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cq2A (A:)
    vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
    lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
    gdfgadaqgamnkalelfrkdiaakykelgyqg