PDB entry 1cq1

View 1cq1 on RCSB PDB site
Description: Soluble Quinoprotein Glucose Dehydrogenase from Acinetobacter Calcoaceticus in Complex with PQQH2 and Glucose
Class: oxidoreductase
Keywords: beta-propeller, superbarrel, complex with cofactor and substrate, oxidoreductase
Deposited on 1999-08-04, released 2000-02-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: soluble quinoprotein glucose dehydrogenase
    Species: Acinetobacter calcoaceticus [TaxId:471]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cq1a_
  • Chain 'B':
    Compound: soluble quinoprotein glucose dehydrogenase
    Species: Acinetobacter calcoaceticus [TaxId:471]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cq1b_
  • Heterogens: BGC, CA, PQQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cq1A (A:)
    dvpltpsqfakaksenfdkkvilsnlnkphallwgpdnqiwlteratgkilrvnpesgsv
    ktvfqvpeivndadgqngllgfafhpdfknnpyiyisgtfknpkstdkelpnqtiirryt
    ynkstdtlekpvdllaglpsskdhqsgrlvigpdqkiyytigdqgrnqlaylflpnqaqh
    tptqqelngkdyhtymgkvlrlnldgsipkdnpsfngvvshiytlghrnpqglaftpngk
    llqseqgpnsddeinlivkggnygwpnvagykddsgyayanysaaanksikdlaqngvkv
    aagvpvtkesewtgknfvpplktlytvqdtynyndptcgemtyicwptvapssayvykgg
    kkaitgwentllvpslkrgvifrikldptysttyddavpmfksnnryrdviaspdgnvly
    vltdtagnvqkddgsvtntlenpgslikftykak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cq1A (A:)
    dvpltpsqfakaksenfdkkvilsnlnkphallwgpdnqiwlteratgkilrvnpesgsv
    ktvfqvpeivndadgqngllgfafhpdfknnpyiyisgtfknpkpnqtiirrytynkstd
    tlekpvdllaglpsskdhqsgrlvigpdqkiyytigdqgrnqlaylflpnqaqhtptqqe
    lngkdyhtymgkvlrlnldgsipkdnpsfngvvshiytlghrnpqglaftpngkllqseq
    gpnsddeinlivkggnygwpnvagykddsgyayanysaaanksikdlaqngvkvaagvpv
    tkesewtgknfvpplktlytvqdtynyndptcgemtyicwptvapssayvykggkkaitg
    wentllvpslkrgvifrikldptysttyddavpmfksnnryrdviaspdgnvlyvltdta
    gnvqkddgsvtntlenpgslikft
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1cq1B (B:)
    dvpltpsqfakaksenfdkkvilsnlnkphallwgpdnqiwlteratgkilrvnpesgsv
    ktvfqvpeivndadgqngllgfafhpdfknnpyiyisgtfknpkstdkelpnqtiirryt
    ynkstdtlekpvdllaglpsskdhqsgrlvigpdqkiyytigdqgrnqlaylflpnqaqh
    tptqqelngkdyhtymgkvlrlnldgsipkdnpsfngvvshiytlghrnpqglaftpngk
    llqseqgpnsddeinlivkggnygwpnvagykddsgyayanysaaanksikdlaqngvkv
    aagvpvtkesewtgknfvpplktlytvqdtynyndptcgemtyicwptvapssayvykgg
    kkaitgwentllvpslkrgvifrikldptysttyddavpmfksnnryrdviaspdgnvly
    vltdtagnvqkddgsvtntlenpgslikftykak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cq1B (B:)
    dvpltpsqfakaksenfdkkvilsnlnkphallwgpdnqiwlteratgkilrvnpesgsv
    ktvfqvpeivndadgqngllgfafhpdfknnpyiyisgtfknpkpnqtiirrytynkstd
    tlekpvdllaglpsskdhqsgrlvigpdqkiyytigdqgrnqlaylflpnqaqhtptqqe
    lngkdyhtymgkvlrlnldgsipkdnpsfngvvshiytlghrnpqglaftpngkllqseq
    gpnsddeinlivkggnygwpnvagykddsgyayanysaaanksikdlaqngvkvaagvpv
    tkesewtgknfvpplktlytvqdtynyndptcgemtyicwptvapssayvykggkkaitg
    wentllvpslkrgvifrikldptysttyddavpmfksnnryrdviaspdgnvlyvltdta
    gnvqkddgsvtntlenpgslikftyk