PDB entry 1cpz

View 1cpz on RCSB PDB site
Description: copper chaperone of enterococcus hirae (apo-form)
Class: gene regulation
Keywords: copper chaperone, metal transport, gene regulation
Deposited on 1999-05-06, released 1999-05-11
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (copz)
    Species: Enterococcus hirae [TaxId:1354]
    Gene: COPZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1cpza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1cpzA (A:)
aqefsvkgmscnhcvarieeavgrisgvkkvkvqlkkekavvkfdeanvqateicqaine
lgyqaevi