PDB entry 1cpz

View 1cpz on RCSB PDB site
Description: copper chaperone of enterococcus hirae (apo-form)
Deposited on 1999-05-06, released 1999-05-11
The last revision prior to the SCOP 1.67 freeze date was dated 1999-12-23, with a file datestamp of 1999-12-22.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.67: d1cpza_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cpzA (A:)
  aqefsvkgmscnhcvarieeavgrisgvkkvkvqlkkekavvkfdeanvqateicqaine
  lgyqaevi