PDB entry 1cpy

View 1cpy on RCSB PDB site
Description: site-directed mutagenesis on (serine) carboxypeptidase y from yeast. the significance of thr 60 and met 398 in hydrolysis and aminolysis reactions
Class: hydrolase (carboxypeptidase)
Keywords: hydrolase (carboxypeptidase)
Deposited on 1995-03-24, released 1995-09-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine carboxypeptidase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00729 (0-420)
      • conflict (64)
      • conflict (144)
    Domains in SCOPe 2.07: d1cpya_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cpyA (A:)
    kikdpkilgidpnvtqytgyldvededkhfffwtfesrndpakdpvilwlnggpgcsslt
    glffalgpssigpdlkpignpyswnsnatvifldqpvnvgfsysgssgvsntvaagkdvy
    nflelffdqfpeyvnkgqdfhiagasyaghyipvfaseilshkdrnfnltsvligngltd
    pltqynyyepmacgeggepsvlpseecsamedslerclgliescydsqsvwscvpatiyc
    nnaqlapyqrtgrnvydirkdceggnlcyptlqdiddylnqdyvkeavgaevdhyescnf
    dinrnflfagdwmkpyhtavtdllnqdlpilvyagdkdficnwlgnkawtdvlpwkydee
    fasqkvrnwtasitdevagevksykhftylrvfngghmvpfdvpenalsmvnewihggfs
    l