PDB entry 1cpx

View 1cpx on RCSB PDB site
Description: beta form of carboxypeptidase a (residues 3-307) from bovine pancreas in an orthorhombic crystal form with two zinc ions in the active site.
Class: hydrolase
Keywords: metalloprotease, hydrolase, carboxypeptidase, zinc inhibition, induced fit
Deposited on 1998-07-27, released 1998-08-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.167
AEROSPACI score: -1.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (carboxypeptidase a)
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00730 (Start-306)
      • conflict (227)
      • conflict (304)
    Domains in SCOPe 2.07: d1cpxa_
  • Heterogens: ZN, OH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cpxA (A:)
    arstntfnyatyhtldeiydfmdllvaehpqlvsklqigrsyegrpiyvlkfstggsnrp
    aiwidlgihsrewitqatgvwfakkftedygqdpsftaildsmdifleivtnpdgfafth
    sqnrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv
    dfvkdhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsyky
    gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti
    mehtvnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cpxA (A:)
    stntfnyatyhtldeiydfmdllvaehpqlvsklqigrsyegrpiyvlkfstggsnrpai
    widlgihsrewitqatgvwfakkftedygqdpsftaildsmdifleivtnpdgfafthsq
    nrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksivdf
    vkdhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsykygs
    iittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvltime
    htvnn