PDB entry 1cps

View 1cps on RCSB PDB site
Description: structural comparison of sulfodiimine and sulfonamide inhibitors in their complexes with zinc enzymes
Class: hydrolase(c-terminal peptidase)
Keywords: hydrolase(c-terminal peptidase)
Deposited on 1992-02-18, released 1993-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.174
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carboxypeptidase a
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00730 (0-306)
      • conflict (88)
      • conflict (92)
      • conflict (113)
      • conflict (121)
      • conflict (184)
      • conflict (227)
      • conflict (304)
    Domains in SCOPe 2.08: d1cpsa_
  • Heterogens: ZN, CPM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1cpsA (A:)
arstntfnyatyhtldeiydfmdllvaehpqlvsklqigrsyegrpiyvlkfstggsnrp
aiwidlgihsrewitqatgvwfakkftenygqnpsftaildsmdifleivtnpngfafth
senrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv
dfvknhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsyky
gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti
mehtvnn