PDB entry 1cpr

View 1cpr on RCSB PDB site
Description: st. louis cytochrome c' from the purple phototropic bacterium, rhodobacter capsulatus
Class: electron transport
Keywords: electron transport, heme protein, cytochrome
Deposited on 1996-04-09, released 1997-01-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.184
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c'
    Species: Rhodobacter capsulatus [TaxId:1061]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cpra_
  • Heterogens: ZN, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cprA (A:)
    adtkevleareayfkslggsmkamtgvakafdaeaakveaaklekilatdvaplfpagts
    stdlpgqteakaaiwanmddfgakgkamhdaggaviaaanagdgaafgaalqklggtcka
    chddyreed