PDB entry 1cpq

View 1cpq on RCSB PDB site
Description: cytochrome c' from rhodopseudomonas capsulata
Class: electron transport
Keywords: electron transport, cytochrome
Deposited on 1995-08-14, released 1996-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.72 Å
R-factor: 0.15
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytochrome c'
  Species: Rhodobacter capsulatus [TaxId:1061]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00147 (0-128)
    • variant (89)
  Domains in SCOPe 2.07: d1cpqa_
• Heterogens: HEM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cpqA (A:)
  adtkevleareayfkslggsmkamtgvakafdaeaakveaaklekilatdvaplfpagts
  stdlpgqteakaaiwanmddfgakgkamheaggaviaaanagdgaafgaalqklggtcka
  chddyreed