PDB entry 1cpq

View 1cpq on RCSB PDB site
Description: cytochrome c' from rhodopseudomonas capsulata
Deposited on 1995-08-14, released 1996-12-07
The last revision prior to the SCOP 1.55 freeze date was dated 1996-12-07, with a file datestamp of 1996-12-08.
Experiment type: XRAY
Resolution: 1.72 Å
R-factor: 0.15
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1cpq__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cpq_ (-)
    adtkevleareayfkslggsmkamtgvakafdaeaakveaaklekilatdvaplfpagts
    stdlpgqteakaaiwanmddfgakgkamheaggaviaaanagdgaafgaalqklggtcka
    chddyreed