PDB entry 1cpq

View 1cpq on RCSB PDB site
Description: cytochrome c' from rhodopseudomonas capsulata
Class: electron transport
Keywords: electron transport, cytochrome
Deposited on 1995-08-14, released 1996-12-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.72 Å
R-factor: 0.15
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c'
    Species: Rhodobacter capsulatus [TaxId:1061]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00147 (0-128)
      • variant (89)
    Domains in SCOPe 2.08: d1cpqa_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cpqA (A:)
    adtkevleareayfkslggsmkamtgvakafdaeaakveaaklekilatdvaplfpagts
    stdlpgqteakaaiwanmddfgakgkamheaggaviaaanagdgaafgaalqklggtcka
    chddyreed