PDB entry 1cpo

View 1cpo on RCSB PDB site
Description: chloroperoxidase
Class: oxidoreductase
Keywords: hydrogen-peroxide oxidoreductase, heme peroxidase, haloperoxidase, oxidoreductase
Deposited on 1996-02-10, released 1997-02-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.182
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chloroperoxidase
    Species: Leptoxyphium fumago [TaxId:5474]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1cpoa1, d1cpoa2
  • Heterogens: NAG, MAN, XYS, MN, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cpoA (A:)
    eepgsgigypydnntlpyvapgptdsrapcpalnalanhgyiphdgraisretlqnafln
    hmgiansvielaltnafvvceyvtgsdcgdslvnltllaephafehdhsfsrkdykqgva
    nsndfidnrnfdaetfqtsldvvagkthfdyadmneirlqreslsneldfpgwfteskpi
    qnvesgfifalvsdfnlpdndenplvridwwkywftnesfpyhlgwhppspareiefvts
    assavlaasvtstpsslpsgaigpgaeavplsfastmtpfllatnapyyaqdptlgpnd