PDB entry 1cpn

View 1cpn on RCSB PDB site
Description: native-like in vivo folding of a circularly permuted jellyroll protein shown by crystal structure analysis
Class: hydrolase(glucanase)
Keywords: hydrolase(glucanase)
Deposited on 1994-03-11, released 1994-06-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-08-14, with a file datestamp of 2019-08-09.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: -3.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: circularly permuted
    Species: Paenibacillus macerans [TaxId:44252]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1cpna_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1cpnA (A:)
fdcaeyrstniygyglyevsmkpakntgivssfftytgpahgtqwdeidieflgkdttkv
qfnyytngvgghekvislgfdaskgfhtyafdwqpgyikwyvdgvlkhtatanipstpgk
immnlwngtgvddwlgsynganplyaeydwvkytsngsvfwepksyfnpstwekadgysn
ggvfnctwrannvnftndgklklgltss