PDB entry 1cpm

View 1cpm on RCSB PDB site
Description: native-like in vivo folding of a circularly permuted jellyroll protein shown by crystal structure analysis
Class: hydrolase(glucanase)
Keywords: hydrolase(glucanase)
Deposited on 1994-03-11, released 1994-06-22
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.153
AEROSPACI score: -3.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: circularly permuted
    Species: Paenibacillus macerans [TaxId:44252]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1cpma_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cpmA (A:)
    fdcaeyrstniygyglyevsmkpakntgivssfftytgpahgtqwdeidieflgkdttkv
    qfnyytngvgghekvislgfdaskgfhtyafdwqpgyikwyvdgvlkhtatanipstpgk
    immnlwngtgvddwlgsynganplyaeydwvkytsnqtggsffepfnsynsgtwekadgy
    snggvfnctwrannvnftndgklklgltssayna