PDB entry 1cpk

View 1cpk on RCSB PDB site
Description: crystal structure of the catalytic subunit of cyclic adenosine monophosphate-*dependent protein kinase
Deposited on 1991-09-21, released 1992-01-15
The last revision was dated 1993-01-15, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    no info in PDB for this chain
  • Chain 'I':
    no info in PDB for this chain
  • Heterogens: PHO

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'E':
    Sequence, based on SEQRES records:
    >1cpkE (E:)
    gnaaaakkgseqesvkeflakakedflkkwedpsqntaqldqfdriktlgtgsfgrvmlv
    khkesgnhyamkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvm
    eyvaggemfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyi
    qvtdfgfakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffa
    dqpiqiyekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkdgvndiknhkwfatt
    dwiaiyqrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkeftef
    

    Sequence, based on observed residues (ATOM records):
    >1cpkE (E:)
    vkeflakakedflkkwedpsqntaqldqfdriktlgtgsfgrvmlvkhkesgnhyamkil
    dkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvaggemfshlrr
    igrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfakrvkgr
    twtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyekivsgk
    vrfpshfssdlkdllrnllqvdltkrfgnlkdgvndiknhkwfattdwiaiyqrkveapf
    ipkfkgpgdtsnfddyeeeeirvsinekcgkeftef
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records:
    >1cpkI (I:)
    ttyadfiasgrtgrrnaihd