PDB entry 1cpj

View 1cpj on RCSB PDB site
Description: crystal structures of recombinant rat cathepsin b and a cathepsin b-inhibitor complex: implications for structure-based inhibitor design
Class: hydrolase
Keywords: thiol protease, hydrolase
Deposited on 1995-07-17, released 1995-12-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-11.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.175
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cathepsin b
    Species: Rattus norvegicus [TaxId:10116]
    Gene: CDNA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00787
      • engineered (120)
      • cloning artifact (228)
    Domains in SCOPe 2.08: d1cpja_
  • Chain 'B':
    Compound: cathepsin b
    Species: Rattus norvegicus [TaxId:10116]
    Gene: CDNA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00787
      • engineered (120)
      • cloning artifact (228)
    Domains in SCOPe 2.08: d1cpjb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cpjA (A:)
    fsedinlpesfdareqwsncptiaqirdqgscgscwafgaveamsdricihtngrvnvev
    saedlltccgiqcgdgcnggypsgawnfwtrkglvsggvynshigclpytippcehhvng
    arppctgegdtpkcnkmceagystsykedkhygytsysvsdsekeimaeiykngpvegaf
    tvfsdfltyksgvykheagdvmgghairilgwgiengvpywlvanswnadwgdngffkil
    rgenhcgieseivagiprtq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cpjA (A:)
    lpesfdareqwsncptiaqirdqgscgscwafgaveamsdricihtngrvnvevsaedll
    tccgiqcgdgcnggypsgawnfwtrkglvsggvynshigclpytippcehhvngarppct
    gegdtpkcnkmceagystsykedkhygytsysvsdsekeimaeiykngpvegaftvfsdf
    ltyksgvykheagdvmgghairilgwgiengvpywlvanswnadwgdngffkilrgenhc
    gieseivagiprt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1cpjB (B:)
    fsedinlpesfdareqwsncptiaqirdqgscgscwafgaveamsdricihtngrvnvev
    saedlltccgiqcgdgcnggypsgawnfwtrkglvsggvynshigclpytippcehhvng
    arppctgegdtpkcnkmceagystsykedkhygytsysvsdsekeimaeiykngpvegaf
    tvfsdfltyksgvykheagdvmgghairilgwgiengvpywlvanswnadwgdngffkil
    rgenhcgieseivagiprtq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cpjB (B:)
    lpesfdareqwsncptiaqirdqgscgscwafgaveamsdricihtngrvnvevsaedll
    tccgiqcgdgcnggypsgawnfwtrkglvsggvynshigclpytippcehhvngarppct
    gegdtpkcnkmceagystsykedkhygytsysvsdsekeimaeiykngpvegaftvfsdf
    ltyksgvykheagdvmgghairilgwgiengvpywlvanswnadwgdngffkilrgenhc
    gieseivagiprt