PDB entry 1cph

View 1cph on RCSB PDB site
Description: conformational changes in cubic insulin crystals in the ph range 7-11
Class: hormone
Keywords: hormone
Deposited on 1992-10-30, released 1993-01-15
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.191
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: insulin (ph 10)
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01317 (0-20)
  Domains in SCOPe 2.01: d1cph.1
• Chain 'B':
  Compound: insulin (ph 10)
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01317 (0-29)
  Domains in SCOPe 2.01: d1cph.1
• Heterogens: NA, DCE, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cphA (A:)
  giveqccasvcslyqlenycn
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cphB (B:)
  fvnqhlcgshlvealylvcgergffytpka