PDB entry 1cph

View 1cph on RCSB PDB site
Description: conformational changes in cubic insulin crystals in the ph range 7-11
Class: hormone
Keywords: hormone
Deposited on 1992-10-30, released 1993-01-15
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 1.9 Å
R-factor: 0.191
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: insulin (ph 10)
    Species: Bos taurus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1cph.1
  • Chain 'B':
    Compound: insulin (ph 10)
    Species: Bos taurus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1cph.1
  • Heterogens: NA, DCE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cphA (A:)
    giveqccasvcslyqlenycn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cphB (B:)
    fvnqhlcgshlvealylvcgergffytpka