PDB entry 1cpf

View 1cpf on RCSB PDB site
Description: a cation binding motif stabilizes the compound I radical of cytochrome c peroxidase
Class: oxidoreductase(h2o2(a))
Keywords: oxidoreductase(h2o2(a))
Deposited on 1994-08-18, released 1994-11-01
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.161
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c peroxidase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00431 (Start-295)
      • conflict (54)
      • conflict (153)
      • conflict (192)
    Domains in SCOPe 2.05: d1cpfa_
  • Heterogens: HEM, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cpfA (A:)
    mittplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwd
    khdntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqe
    mqgpkipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalg
    kthlknsgyegpggaannvftnefylnllnedwklekndanneqwdsksgymmlptdysl
    iqdpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cpfA (A:)
    lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdnt
    ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
    ipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthlk
    nsgyegpggaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpk
    ylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl