PDB entry 1cpc

View 1cpc on RCSB PDB site
Description: isolation, crystallization, crystal structure analysis and refinement of constitutive c-phycocyanin from the chromatically adapting cyanobacterium fremyella diplosiphon at 1.66 angstroms resolution
Class: light harvesting protein
Keywords: light harvesting protein
Deposited on 1990-10-11, released 1993-01-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-04-10, with a file datestamp of 2013-04-05.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: 0.181
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: c-phycocyanin (alpha subunit)
    Species: Fremyella diplosiphon [TaxId:1197]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cpca_
  • Chain 'B':
    Compound: c-phycocyanin (beta subunit)
    Species: Fremyella diplosiphon [TaxId:1197]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07119 (0-171)
      • conflict (168)
    Domains in SCOPe 2.07: d1cpcb_
  • Chain 'K':
    Compound: c-phycocyanin (alpha subunit)
    Species: Fremyella diplosiphon [TaxId:1197]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cpck_
  • Chain 'L':
    Compound: c-phycocyanin (beta subunit)
    Species: Fremyella diplosiphon [TaxId:1197]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07119 (0-171)
      • conflict (168)
    Domains in SCOPe 2.07: d1cpcl_
  • Heterogens: CYC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cpcA (A:)
    mktplteavaaadsqgrflssteiqtafgrfrqasaslaaakaltekasslasgaanavy
    skfpyttsqngpnfastqtgkdkcvrdigyylrmvtyclvvggtgplddyliggiaeinr
    tfdlspswyvealkyikanhglsgdpaveansyidyainals
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cpcB (B:)
    mldafakvvsqadargeylsgsqidalsalvadgnkrmdvvnritgnsstivanaarslf
    aeqpqliapggnaytsrrmaaclrdmeiilryvtyaifagdasvlddrclnglketylal
    gtpgssvavgvqkmkdaalaiagdtngitrgdcaslmaevasyfdkaasava
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cpcK (K:)
    mktplteavaaadsqgrflssteiqtafgrfrqasaslaaakaltekasslasgaanavy
    skfpyttsqngpnfastqtgkdkcvrdigyylrmvtyclvvggtgplddyliggiaeinr
    tfdlspswyvealkyikanhglsgdpaveansyidyainals
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cpcL (L:)
    mldafakvvsqadargeylsgsqidalsalvadgnkrmdvvnritgnsstivanaarslf
    aeqpqliapggnaytsrrmaaclrdmeiilryvtyaifagdasvlddrclnglketylal
    gtpgssvavgvqkmkdaalaiagdtngitrgdcaslmaevasyfdkaasava