PDB entry 1cpb

View 1cpb on RCSB PDB site
Description: structure of carboxypeptidase b at 2.8 angstroms resolution
Class: hydrolase (c-terminal peptidase)
Keywords: hydrolase (c-terminal peptidase)
Deposited on 1976-06-23, released 1977-11-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carboxypeptidase b
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1cpb.1
  • Chain 'B':
    Compound: carboxypeptidase b
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1cpb.1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cpbA (A:)
    ttghsyekynnwetieawteqvasenpdlisrsaigttflgntiyllkvgkpgsnkpavf
    mdcgfharewispafcqwfvre
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cpbB (B:)
    eihmtefldkldfyvlpvvnidgyiytwttnrmwrktrstragssctgtdlnrnfdagwc
    sigasnnpcsetycgsaaesekeskavadfirnhlssikayltihsysqmmlypysydyk
    lpknnvelntlakgavkklaslhgttysygpgattiypasggsddwaydqgikysftfel
    rdkgrygfvlpesqiqptceetmlaikyvtsyvlehl