PDB entry 1cpa

View 1cpa on RCSB PDB site
Description: carboxypeptidase a,a protein and an enzyme
Deposited on 1973-02-01, released 1973-02-01
The last revision was dated 1973-02-01, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    no info in PDB for this chain
  • Chain 'S':
    no info in PDB for this chain
  • Chain 'p':
    no info in PDB for this chain
  • Heterogens: ZN

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records:
    >1cpa_ (-)
    arstntfnyatyhtldeiydfmdllvaqhpelvsklqigrsyegrpiyvlkfstggsnrp
    aiwidlgihsrewitqatgvwfakkftenygqnpsftaildsmdifleivtnpngfafth
    senrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv
    dfvknhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsyky
    gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti
    mehtvnn
    

  • Chain 'S':
    No sequence available.

  • Chain 'p':
    No sequence available.