PDB entry 1cp7

View 1cp7 on RCSB PDB site
Description: aminopeptidase from streptomyces griseus
Class: hydrolase
Keywords: aminopeptidase, zymogen, zinc, hydrolase
Deposited on 1999-06-10, released 2000-05-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: 0.144
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aminopeptidase
    Species: Streptomyces griseus [TaxId:1911]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cp7a_
  • Heterogens: ZN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cp7A (A:)
    apdiplanvkahltqlstiaannggnrahgrpgykasvdyvkakldaagytttlqqftsg
    gatgynlianwpggdpnkvlmagahldsvssgagindngsgsaavletalavsragyqpd
    khlrfawwgaeelgligskfyvnnlpsadrsklagylnfdmigspnpgyfvydddpviek
    tfknyfaglnvpteietegdgrsdhapfknvgvpvgglftgagytksaaqaqkwggtagq
    afdrcyhsscdslsnindtaldrnsdaaahaiwtlssgtgeppt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cp7A (A:)
    apdiplanvkahltqlstiaannggnrahgrpgykasvdyvkakldaagytttlqqftsg
    gatgynlianwpggdpnkvlmagahldsvssgagindngsgsaavletalavsragyqpd
    khlrfawwgaeelgligskfyvnnlpsadrsklagylnfdmigspnpgyfvydddpviek
    tfknyfaglnvpteietersdhapfknvgvpvgglftgagytksaaqaqkwggtagqafd
    rcyhsscdslsnindtaldrnsdaaahaiwtlss