PDB entry 1cp3

View 1cp3 on RCSB PDB site
Description: crystal structure of the complex of apopain with the tetrapeptide inhibitor ace-dvad-fmc
Class: hydrolase/hydrolase inhibitor
Keywords: HYDROLASE-HYDROLASE INHIBITOR COMPLEX, APOPTOSIS, interleukin-1beta-converting enzyme, CYSTEINE-PROTEASE
Deposited on 1996-12-12, released 1997-12-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.188
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: apopain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1cp3a_
  • Chain 'B':
    Compound: apopain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1cp3b_
  • Chain 'C':
    Compound: acetyl-asp-val-ala-asp-fluoromethylketone
    Database cross-references and differences (RAF-indexed):
    • PDB 1CP3 (Start-4)
  • Chain 'D':
    Compound: acetyl-asp-val-ala-asp-fluoromethylketone
    Database cross-references and differences (RAF-indexed):
    • PDB 1CP3 (Start-4)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cp3A (A:)
    mentensvdsksiknlepkiihgsesmdsgisldnsykmdypemglciiinnknfhkstg
    mtsrsgtdvdaanlretfrnlkyevrnkndltreeivelmrdvskedhskrssfvcvlls
    hgeegiifgtngpvdlkkitnffrgdrcrsltgkpklfiiqacrgteldcgietdsgvdd
    dmachkipvdadflyaystapgyyswrnskdgswfiqslcamlkqyadklefmhiltrvn
    rkvatefesfsfdatfhakkqipcivsmltkelyfyh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cp3A (A:)
    nsykmdypemglciiinnknfhkstgmtsrsgtdvdaanlretfrnlkyevrnkndltre
    eivelmrdvskedhskrssfvcvllshgeegiifgtngpvdlkkitnffrgdrcrsltgk
    pklfiiqacrgteldcgiehkipvdadflyaystapgyyswrnskdgswfiqslcamlkq
    yadklefmhiltrvnrkvatefesfsfdatfhakkqipcivsmltkelyfyh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1cp3B (B:)
    mentensvdsksiknlepkiihgsesmdsgisldnsykmdypemglciiinnknfhkstg
    mtsrsgtdvdaanlretfrnlkyevrnkndltreeivelmrdvskedhskrssfvcvlls
    hgeegiifgtngpvdlkkitnffrgdrcrsltgkpklfiiqacrgteldcgietdsgvdd
    dmachkipvdadflyaystapgyyswrnskdgswfiqslcamlkqyadklefmhiltrvn
    rkvatefesfsfdatfhakkqipcivsmltkelyfyh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cp3B (B:)
    nsykmdypemglciiinnknfhkstgmtsrsgtdvdaanlretfrnlkyevrnkndltre
    eivelmrdvskedhskrssfvcvllshgeegiifgtngpvdlkkitnffrgdrcrsltgk
    pklfiiqacrgteldcgiehkipvdadflyaystapgyyswrnskdgswfiqslcamlkq
    yadklefmhiltrvnrkvatefesfsfdatfhakkqipcivsmltkelyfyh
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.