PDB entry 1cp2

View 1cp2 on RCSB PDB site
Description: nitrogenase iron protein from clostridium pasteurianum
Deposited on 1998-05-11, released 1998-11-04
The last revision prior to the SCOP 1.55 freeze date was dated 1998-11-18, with a file datestamp of 1998-11-18.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.209
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1cp2a_
  • Chain 'B':
    Domains in SCOP 1.55: d1cp2b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cp2A (A:)
    mrqvaiygkggigkstttqnltsglhamgktimvvgcdpkadstrlllgglaqksvldtl
    reegedveldsilkegyggircvesggpepgvgcagrgiitsinmleqlgaytddldyvf
    ydvlgdvvcggfampiregkaqeiyivasgemmalyaanniskgiqkyaksggvrlggii
    cnsrkvaneyelldafakelgsqlihfvprspmvtkaeinkqtvieydptceqaeeyrel
    arkvdanelfvipkpmtqerleeilmqyg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cp2B (B:)
    mrqvaiygkggigkstttqnltsglhamgktimvvgcdpkadstrlllgglaqksvldtl
    reegedveldsilkegyggircvesggpepgvgcagrgiitsinmleqlgaytddldyvf
    ydvlgdvvcggfampiregkaqeiyivasgemmalyaanniskgiqkyaksggvrlggii
    cnsrkvaneyelldafakelgsqlihfvprspmvtkaeinkqtvieydptceqaeeyrel
    arkvdanelfvipkpmtqerleeilmqyg