PDB entry 1cp2

View 1cp2 on RCSB PDB site
Description: nitrogenase iron protein from clostridium pasteurianum
Class: oxidoreductase
Keywords: oxidoreductase, nitrogenase iron protein
Deposited on 1998-05-11, released 1998-11-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-03-24, with a file datestamp of 2009-03-20.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.209
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrogenase iron protein
    Species: Clostridium pasteurianum [TaxId:1501]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cp2a_
  • Chain 'B':
    Compound: nitrogenase iron protein
    Species: Clostridium pasteurianum [TaxId:1501]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cp2b_
  • Heterogens: SF4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cp2A (A:)
    mrqvaiygkggigkstttqnltsglhamgktimvvgcdpkadstrlllgglaqksvldtl
    reegedveldsilkegyggircvesggpepgvgcagrgiitsinmleqlgaytddldyvf
    ydvlgdvvcggfampiregkaqeiyivasgemmalyaanniskgiqkyaksggvrlggii
    cnsrkvaneyelldafakelgsqlihfvprspmvtkaeinkqtvieydptceqaeeyrel
    arkvdanelfvipkpmtqerleeilmqyg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cp2B (B:)
    mrqvaiygkggigkstttqnltsglhamgktimvvgcdpkadstrlllgglaqksvldtl
    reegedveldsilkegyggircvesggpepgvgcagrgiitsinmleqlgaytddldyvf
    ydvlgdvvcggfampiregkaqeiyivasgemmalyaanniskgiqkyaksggvrlggii
    cnsrkvaneyelldafakelgsqlihfvprspmvtkaeinkqtvieydptceqaeeyrel
    arkvdanelfvipkpmtqerleeilmqyg