PDB entry 1coz

View 1coz on RCSB PDB site
Description: ctp:glycerol-3-phosphate cytidylyltransferase from bacillus subtilis
Class: transferase
Keywords: transferase
Deposited on 1999-05-29, released 1999-10-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.196
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (glycerol-3-phosphate cytidylyltransferase)
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1coza_
  • Chain 'B':
    Compound: protein (glycerol-3-phosphate cytidylyltransferase)
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cozb_
  • Heterogens: CTP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cozA (A:)
    mkkvitygtfdllhwghikllerakqlgdylvvaistdefnlqkqkkayhsyehrklile
    tiryvdevipeknweqkkqdiidhnidvfvmgddwegkfdflkdqcevvylprtegistt
    kikeeiagl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cozA (A:)
    mkkvitygtfdllhwghikllerakqlgdylvvaistdefnlqkqkkayhsyehrklile
    tiryvdevipeknweqkkqdiidhnidvfvmgddwegkfdflkdqcevvylprtegistt
    kikeei
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1cozB (B:)
    mkkvitygtfdllhwghikllerakqlgdylvvaistdefnlqkqkkayhsyehrklile
    tiryvdevipeknweqkkqdiidhnidvfvmgddwegkfdflkdqcevvylprtegistt
    kikeeiagl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cozB (B:)
    mkkvitygtfdllhwghikllerakqlgdylvvaistdefnlqkqkkayhsyehrklile
    tiryvdevipeknweqkkqdiidhnidvfvmgddwegkfdflkdqcevvylprtegistt
    kikeei