PDB entry 1coy

View 1coy on RCSB PDB site
Description: crystal structure of cholesterol oxidase complexed with a steroid substrate. implications for fad dependent alcohol oxidases
Class: oxidoreductase(oxygen receptor)
Keywords: oxidoreductase(oxygen receptor)
Deposited on 1993-06-14, released 1993-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cholesterol oxidase
    Species: Brevibacterium sterolicum [TaxId:1702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22637
      • conflict (436)
      • conflict (491)
    Domains in SCOPe 2.07: d1coya1, d1coya2
  • Heterogens: AND, FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1coyA (A:)
    apsrtladgdrvpalvigsgyggavaalrltqagiptqivemgrswdtpgsdgkifcgml
    npdkrsmwladktdqpvsnfmgfginksidryvgvldserfsgikvyqgrgvgggslvng
    gmavtpkrnyfeeilpsvdsnemynkyfprantglgvnnidqawfestewykfartgrkt
    aqrsgfttafvpnvydfeymkkeaagqvtksglggeviygnnagkksldktylaqaaatg
    kltittlhrvtkvapatgsgysvtmeqideqgnvvatkvvtadrvffaagsvgtskllvs
    mkaqghlpnlssqvgegwgnngnimvgranhmwdatgskqatiptmgidnwadptapifa
    eiaplpagletyvslylaitknperarfqfnsgtgkvdltwaqsqnqkgidmakkvfdki
    nqkegtiyrtdlfgvyyktwgddftyhplggvllnkatdnfgrlpeypglyvvdgslvpg
    nvgvnpfvtitalaernmdkiissdiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1coyA (A:)
    rtladgdrvpalvigsgyggavaalrltqagiptqivemgrswdtpgsdgkifcgmlnpd
    krsmwladktdqpvsnfmgfginksidryvgvldserfsgikvyqgrgvgggslvnggma
    vtpkrnyfeeilpsvdsnemynkyfprantglgvnnidqawfestewykfartgrktaqr
    sgfttafvpnvydfeymkkeaagqvtksglggeviygnnagkksldktylaqaaatgklt
    ittlhrvtkvapatgsgysvtmeqideqgnvvatkvvtadrvffaagsvgtskllvsmka
    qghlpnlssqvgegwgnngnimvgranhmwdatgskqatiptmgidnwadptapifaeia
    plpagletyvslylaitknperarfqfnsgtgkvdltwaqsqnqkgidmakkvfdkinqk
    egtiyrtdlfyyktwgddftyhplggvllnkatdnfgrlpeypglyvvdgslvpgnvgvn
    pfvtitalaernmdkiissdi