PDB entry 1cox

View 1cox on RCSB PDB site
Description: crystal structure of cholesterol oxidase from brevibacterium $sterolicum refined at 1.8 angstroms resolution
Deposited on 1991-02-21, released 1992-01-15
The last revision was dated 1993-10-31, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    no info in PDB for this chain
  • Chain 'p':
    no info in PDB for this chain
  • Heterogens: FAD, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records:
    >1cox_ (-)
    aladgdavpavvigsgyggavaalrltqagvptqivemgrswdtpgadgkifcgmlnpdk
    rsmwlatktdqpvagfmgfginasidryvgvldseafsgisvyqgrgvgggslvnggmav
    tpkrsyfeeilpsvdssemynkyfprantglgvndidqawfestewysfartgrktaqrs
    gfttafvpnvydfeymkseaagqvtksglggeviygnnagkqsldktylasaaatgklti
    ttlhkvtetapaaaagysitmeqideegnvvasktvtanrvffaagsvgtskllvsmkaq
    ghlpnlssqvgegwgnngnimtgranhawdatgssqatipvmgidnwanpaapifaeiap
    lpagletyvslylaitknperarfqfnagsgkvdltwaqsqnskginmaksvfdkinkke
    gtiyrtdlfaaayatwgddftyhplggvllnsatdnfgrlpeypglyvvdgslvpgnvgv
    npfvtitalaernmdkiissdv
    

  • Chain 'p':
    No sequence available.