PDB entry 1cov

View 1cov on RCSB PDB site
Description: coxsackievirus b3 coat protein
Class: Virus
Keywords: COXSACKIEVIRUS B3, Icosahedral virus, Virus
Deposited on 1994-10-19, released 1996-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.264
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: coxsackievirus coat protein
    Species: Human coxsackievirus B3 [TaxId:12072]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cov1_
  • Chain '2':
    Compound: coxsackievirus coat protein
    Species: Human coxsackievirus B3 [TaxId:12072]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q66282 (Start-262)
      • conflict (150)
      • conflict (244)
    Domains in SCOPe 2.07: d1cov.1
  • Chain '3':
    Compound: coxsackievirus coat protein
    Species: Human coxsackievirus B3 [TaxId:12072]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q66282 (0-237)
      • conflict (233)
    Domains in SCOPe 2.07: d1cov3_
  • Chain '4':
    Compound: coxsackievirus coat protein
    Species: Human coxsackievirus B3 [TaxId:12072]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cov.1
  • Heterogens: MYR, PLM

PDB Chain Sequences:

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >1cov1 (1:)
    gpvedaitaaigrvadtvgtgptnseaipaltaaetghtsqvvpsdtmqtrhvknyhsrs
    estienflcrsacvyfteyensgakryaewvitprqaaqlrrklefftyvrfdleltfvi
    tstqqpsttqnqdaqilthqimyvppggpvpdkvdsyvwqtstnpsvfwtegnapprmsv
    pflsignaysnfydgwsefsrngvygintlnnmgtlyarhvnagstgpikstiriyfkpk
    hvkawiprpprlcqyekaknvnfqpsgvtttrqsittmtnt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cov1 (1:)
    rvadtvgtgptnseaipaltaaetghtsqvvpsdtmqtrhvknyhsrsestienflcrsa
    cvyfteyensgakryaewvitprqaaqlrrklefftyvrfdleltfvitstqqpsttqnq
    daqilthqimyvppggpvpdkvdsyvwqtstnpsvfwtegnapprmsvpflsignaysnf
    ydgwsefsrngvygintlnnmgtlyarhvnagstgpikstiriyfkpkhvkawiprpprl
    cqyekaknvnfqpsgvtttrqsittmtnt
    

  • Chain '2':
    Sequence, based on SEQRES records: (download)
    >1cov2 (2:)
    sptveecgysdrvrsitlgnstittqecanvvvgygvwpdylkdseataedqptqpdvat
    crfytldsvqwqktspgwwwklpdalsnlglfgqnmqyhylgrtgytihvqcnaskfhqg
    cllvvcvpeaemgcatlnntpssaellggdtakefadkpvasgsnklvqrvvynagmgvg
    vgnltifphqwinlrtnnsativmpytnsvpmdnmfrhnnvtlmvipfvpldycpgstty
    vpitvtiapmcaeynglrlaghq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cov2 (2:)
    gysdrvrsitlgnstittqecanvvvgygvwpdylkdseataedqptqpdvatcrfytld
    svqwqktspgwwwklpdalsnlglfgqnmqyhylgrtgytihvqcnaskfhqgcllvvcv
    peaemgcatlnntpssaellggdtakefadkpvasgsnklvqrvvynagmgvgvgnltif
    phqwinlrtnnsativmpytnsvpmdnmfrhnnvtlmvipfvpldycpgsttyvpitvti
    apmcaeynglrlaghq
    

  • Chain '3':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cov3 (3:)
    glptmntpgscqfltsddfqspsampqydvtpemripgevknlmeiaevdsvvpvqnvge
    kvnsmeayqipvrsnegsgtqvfgfplqpgyssvfsrtllgeilnyythwsgsikltfmf
    cgsamatgkfllaysppgagaptkrvdamlgthvvwdvglqsscvlcipwisqthyryva
    sdeytaggfitcwyqtnivvpadaqsscyimcfvsacndfsvrllkdtpfisqenffq
    

  • Chain '4':
    Sequence, based on SEQRES records: (download)
    >1cov4 (4:)
    gaqvstqktgahetglnasgnsiihytninyykdaasnsanrqdftqdpskftepvkdim
    ikslpaln
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cov4 (4:)
    gaqvstqktgihytninyykdaasnsanrqdftqdpskftepvkdimikslpaln