PDB entry 1cou

View 1cou on RCSB PDB site
Description: anticoagulant protein from the nematode ancylostoma caninum
Class: blood clotting
Keywords: anticoagulant, protease inhibitor, blood clotting
Deposited on 1999-05-28, released 1999-10-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (nematode anticoagulant protein c2)
    Species: Ancylostoma caninum [TaxId:29170]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16938 (0-83)
      • see remark 999 (84)
    Domains in SCOPe 2.08: d1coua_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1couA (A:)
    katmqcgenekydscgskecdkkckydgveeeddeepnvpclvrvchqdcvceegfyrnk
    ddkcvsaedceldnmdfiypgtrnp