PDB entry 1cor

View 1cor on RCSB PDB site
Description: investigation of the solution conformation of cytochrome c-551 from pseudomonas stutzeri
Class: electron transport
Keywords: electron transport
Deposited on 1993-06-23, released 1993-10-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c551
    Species: Pseudomonas stutzeri [TaxId:316]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1cora_
  • Heterogens: HEM

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1corA (A:)
    edgealfkskpcaachsidaklvgpafkevaakyagqdgaadllaghikngsqgvwgpip
    mppnpvteeeakilaewilsqk