PDB entry 1cor

View 1cor on RCSB PDB site
Description: investigation of the solution conformation of cytochrome c-551 from pseudomonas stutzeri
Deposited on 1993-06-23, released 1993-10-31
The last revision prior to the SCOP 1.63 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.63: d1cor__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cor_ (-)
  edgealfkskpcaachsidaklvgpafkevaakyagqdgaadllaghikngsqgvwgpip
  mppnpvteeeakilaewilsqk