PDB entry 1cor

View 1cor on RCSB PDB site
Description: investigation of the solution conformation of cytochrome c-551 from pseudomonas stutzeri
Class: electron transport
Keywords: electron transport
Deposited on 1993-06-23, released 1993-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-03-10, with a file datestamp of 2021-03-05.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytochrome c551
  Species: Pseudomonas stutzeri [TaxId:316]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00101 (1-81)
  Domains in SCOPe 2.08: d1cora_
• Heterogens: HEC

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1corA (A:)
  edgealfkskpcaachsidaklvgpafkevaakyagqdgaadllaghikngsqgvwgpip
  mppnpvteeeakilaewilsqk