PDB entry 1cop

View 1cop on RCSB PDB site
Description: three-dimensional dimer structure of the lambda-cro repressor in solution as determined by heteronuclear multidimensional nmr
Deposited on 1995-06-23, released 1995-10-15
The last revision prior to the SCOP 1.65 freeze date was dated 1995-10-15, with a file datestamp of 1995-10-16.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'D':
    Domains in SCOP 1.65: d1copd_
  • Chain 'E':
    Domains in SCOP 1.65: d1cope_

PDB Chain Sequences:

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1copD (D:)
meqritlkdyamrfgqtktakdlgvyqsainkaihagrkifltinadgsvyaeevkpfps
nkktta

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1copE (E:)
meqritlkdyamrfgqtktakdlgvyqsainkaihagrkifltinadgsvyaeevkpfps
nkktta