PDB entry 1coo

View 1coo on RCSB PDB site
Description: the cooh-terminal domain of rna polymerase alpha subunit
Deposited on 1995-10-09, released 1996-03-08
The last revision prior to the SCOP 1.59 freeze date was dated 1996-03-08, with a file datestamp of 1996-03-11.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.59: d1coo__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1coo_ (-)
  fdpillrpvddleltvrsanclkaeaihyigdlvqrtevellktpnlgkkslteikdvla
  srglslgmrlenwppasiade