PDB entry 1com

View 1com on RCSB PDB site
Description: the monofunctional chorismate mutase from bacillus subtilis: structure determination of chorismate mutase and its complexes with a transition state analog and prephenate, and implications on the mechanism of enzymatic reaction
Deposited on 1994-04-08, released 1994-06-22
The last revision prior to the SCOP 1.55 freeze date was dated 1994-06-22, with a file datestamp of 1994-06-24.
Experiment type: -
Resolution: 2.2 Å
R-factor: 0.179
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1coma_
  • Chain 'B':
    Domains in SCOP 1.55: d1comb_
  • Chain 'C':
    Domains in SCOP 1.55: d1comc_
  • Chain 'D':
    Domains in SCOP 1.55: d1comd_
  • Chain 'E':
    Domains in SCOP 1.55: d1come_
  • Chain 'F':
    Domains in SCOP 1.55: d1comf_
  • Chain 'G':
    Domains in SCOP 1.55: d1comg_
  • Chain 'H':
    Domains in SCOP 1.55: d1comh_
  • Chain 'I':
    Domains in SCOP 1.55: d1comi_
  • Chain 'J':
    Domains in SCOP 1.55: d1comj_
  • Chain 'K':
    Domains in SCOP 1.55: d1comk_
  • Chain 'L':
    Domains in SCOP 1.55: d1coml_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1comA (A:)
    mirgirgattverdteeeilqktkqllekiieenhtkpedvvqmllsatpdlhavfpaka
    vrelsgwqyvpvtcmqemdvtgglkkcirvmmtvqtdvpqdqirhvylekavvl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1comB (B:)
    mirgirgattverdteeeilqktkqllekiieenhtkpedvvqmllsatpdlhavfpaka
    vrelsgwqyvpvtcmqemdvtgglkkcirvmmtvqtdvpqdqirhvylekavvlrpdl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1comC (C:)
    mirgirgattverdteeeilqktkqllekiieenhtkpedvvqmllsatpdlhavfpaka
    vrelsgwqyvpvtcmqemdvtgglkkcirvmmtvqtdvpqdqirhvylekavvlrpdls
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1comD (D:)
    mirgirgattverdteeeilqktkqllekiieenhtkpedvvqmllsatpdlhavfpaka
    vrelsgwqyvpvtcmqemdvtgglkkcirvmmtvqtdvpqdqirhvylekavvl
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1comE (E:)
    mirgirgattverdteeeilqktkqllekiieenhtkpedvvqmllsatpdlhavfpaka
    vrelsgwqyvpvtcmqemdvtgglkkcirvmmtvqtdvpqdqirhvylekavvlrpdl
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1comF (F:)
    mirgirgattverdteeeilqktkqllekiieenhtkpedvvqmllsatpdlhavfpaka
    vrelsgwqyvpvtcmqemdvtgglkkcirvmmtvqtdvpqdqirhvylekavvlrpd
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1comG (G:)
    mirgirgattverdteeeilqktkqllekiieenhtkpedvvqmllsatpdlhavfpaka
    vrelsgwqyvpvtcmqemdvtgglkkcirvmmtvqtdvpqdqirhvylekavvl
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1comH (H:)
    mirgirgattverdteeeilqktkqllekiieenhtkpedvvqmllsatpdlhavfpaka
    vrelsgwqyvpvtcmqemdvtgglkkcirvmmtvqtdvpqdqirhvylekavvl
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1comI (I:)
    mirgirgattverdteeeilqktkqllekiieenhtkpedvvqmllsatpdlhavfpaka
    vrelsgwqyvpvtcmqemdvtgglkkcirvmmtvqtdvpqdqirhvylekavvl
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1comJ (J:)
    mirgirgattverdteeeilqktkqllekiieenhtkpedvvqmllsatpdlhavfpaka
    vrelsgwqyvpvtcmqemdvtgglkkcirvmmtvqtdvpqdqirhvylekavvl
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1comK (K:)
    mirgirgattverdteeeilqktkqllekiieenhtkpedvvqmllsatpdlhavfpaka
    vrelsgwqyvpvtcmqemdvtgglkkcirvmmtvqtdvpqdqirhvylekavvlrp
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1comL (L:)
    mirgirgattverdteeeilqktkqllekiieenhtkpedvvqmllsatpdlhavfpaka
    vrelsgwqyvpvtcmqemdvtgglkkcirvmmtvqtdvpqdqirhvylekavvl