PDB entry 1col

View 1col on RCSB PDB site
Description: refined structure of the pore-forming domain of colicin a at 2.4 angstroms resolution
Class: antibacterial protein
Keywords: antibacterial protein
Deposited on 1991-07-06, released 1992-07-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.18
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: colicin a
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cola_
  • Chain 'B':
    Compound: colicin a
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1colb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1colA (A:)
    vaekakderellektseliagmgdkigehlgdkykaiakdiadniknfqgktirsfddam
    aslnkitanpamkinkadrdalvnawkhvdaqdmanklgnlskafkvadvvmkvekvrek
    siegyetgnwgplmleveswvlsgiassvalgifsatlgayalslgvpaiavgiagilla
    avvgaliddkfadalnneiirpah
    

    Sequence, based on observed residues (ATOM records): (download)
    >1colA (A:)
    akderellektseliagmgdkigehlgdkykaiakdiadniknfqgktirsfddamasln
    kitanpamkinkadrdalvnawkhvdaqdmanklgnlskafkvadvvmkvekvreksieg
    yetgnwgplmleveswvlsgiassvalgifsatlgayalslgvpaiavgiagillaavvg
    aliddkfadalnneiir
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1colB (B:)
    vaekakderellektseliagmgdkigehlgdkykaiakdiadniknfqgktirsfddam
    aslnkitanpamkinkadrdalvnawkhvdaqdmanklgnlskafkvadvvmkvekvrek
    siegyetgnwgplmleveswvlsgiassvalgifsatlgayalslgvpaiavgiagilla
    avvgaliddkfadalnneiirpah
    

    Sequence, based on observed residues (ATOM records): (download)
    >1colB (B:)
    akderellektseliagmgdkigehlgdkykaiakdiadniknfqgktirsfddamasln
    kitanpamkinkadrdalvnawkhvdaqdmanklgnlskafkvadvvmkvekvreksieg
    yetgnwgplmleveswvlsgiassvalgifsatlgayalslgvpaiavgiagillaavvg
    aliddkfadalnneiir