PDB entry 1cok

View 1cok on RCSB PDB site
Description: structure of the c-terminal domain of p73
Deposited on 1999-05-28, released 1999-08-17
The last revision prior to the SCOP 1.69 freeze date was dated 1999-08-17, with a file datestamp of 1999-08-16.
Experiment type: NMR18
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.69: d1coka_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cokA (A:)
  yhadpslvsfltglgcpncieyftsqglqsiyhlqnltiedlgalkipeqyrmtiwrglq
  dlkqghdy