PDB entry 1cok

View 1cok on RCSB PDB site
Description: structure of the c-terminal domain of p73
Class: gene regulation
Keywords: p73 sam-like domain, gene regulation
Deposited on 1999-05-28, released 1999-08-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (second splice variant p73)
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O15350 (0-67)
  Domains in SCOPe 2.08: d1coka_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cokA (A:)
  yhadpslvsfltglgcpncieyftsqglqsiyhlqnltiedlgalkipeqyrmtiwrglq
  dlkqghdy