PDB entry 1cof

View 1cof on RCSB PDB site
Description: yeast cofilin, orthorhombic crystal form
Deposited on 1996-11-26, released 1997-04-01
The last revision prior to the SCOP 1.57 freeze date was dated 1997-04-01, with a file datestamp of 1997-04-02.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.184
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1cof__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cof_ (-)
    vavadesltafndlklgkkykfilfglndakteivvketstdpsydafleklpendclya
    iydfeyeingnegkrskivfftwspdtapvrskmvyasskdalrralngvstdvqgtdfs
    evsydsvlervsrga