PDB entry 1cof

View 1cof on RCSB PDB site
Description: yeast cofilin, orthorhombic crystal form
Class: actin-binding protein
Keywords: actin-binding, cytoskeleton, actin-binding protein
Deposited on 1996-11-26, released 1997-04-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.184
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cofilin
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cofa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cofA (A:)
    msrsgvavadesltafndlklgkkykfilfglndakteivvketstdpsydafleklpen
    dclyaiydfeyeingnegkrskivfftwspdtapvrskmvyasskdalrralngvstdvq
    gtdfsevsydsvlervsrgagsh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cofA (A:)
    vavadesltafndlklgkkykfilfglndakteivvketstdpsydafleklpendclya
    iydfeyeingnegkrskivfftwspdtapvrskmvyasskdalrralngvstdvqgtdfs
    evsydsvlervsrga