PDB entry 1coe

View 1coe on RCSB PDB site
Description: solution conformation of cobrotoxin: a nuclear magnetic resonance and hybrid distance geometry-dynamical simulated annealing study
Deposited on 1994-05-11, released 1995-01-26
The last revision prior to the SCOP 1.65 freeze date was dated 1995-07-20, with a file datestamp of 1995-08-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.65: d1coe__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1coe_ (-)
    lechnqqssqtptttgcsggetncykkrwrdhrgyrtergcgcpsvkngieinccttdrc
    nn