PDB entry 1cod

View 1cod on RCSB PDB site
Description: solution conformation of cobrotoxin: a nuclear magnetic resonance and hybrid distance geometry-dynamical simulated annealing study
Class: short neurotoxin
Keywords: short neurotoxin
Deposited on 1994-05-11, released 1995-01-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-08-25, with a file datestamp of 2009-08-21.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cobrotoxin
    Species: Naja atra [TaxId:8656]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1coda_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1codA (A:)
    lechnqqssqtptttgcsggetncykkrwrdhrgyrtergcgcpsvkngieinccttdrc
    nn