PDB entry 1coa

View 1coa on RCSB PDB site
Description: the effect of cavity creating mutations in the hydrophobic core of chymotrypsin inhibitor 2
Class: serine protease inhibitor
Keywords: serine protease inhibitor
Deposited on 1993-05-14, released 1994-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'I':
    Compound: chymotrypsin inhibitor 2
    Species: Hordeum vulgare [TaxId:4513]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01053 (1-63)
      • conflict (56)
      • conflict (58)
    Domains in SCOPe 2.08: d1coai_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1coaI (I:)
    mktewpelvgksveeakkvilqdkpeaqiivlpvgtivtmeyridrvrlfvdkldnvaev
    prvg