PDB entry 1co9

View 1co9 on RCSB PDB site
Description: recombinant sperm whale myoglobin l104v mutant (met)
Class: oxygen transport
Keywords: oxygen transport, heme, muscle protein
Deposited on 1999-06-07, released 1999-06-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.143
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (myoglobin)
    Species: Physeter catodon [TaxId:9755]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (0-153)
      • see remark 999 (0)
      • engineered (104)
      • engineered (122)
    Domains in SCOPe 2.06: d1co9a_
  • Heterogens: SO4, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1co9A (A:)
    mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
    dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikyvefiseaiihvlhsrh
    pgnfgadaqgamnkalelfrkdiaakykelgyqg